PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_026719
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family G2-like
Protein Properties Length: 318aa    MW: 35528.7 Da    PI: 8.9002
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_026719genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.45e-31172227156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rF++a++qLGG+++ tPk+i+elmkv+gLt+++vkSHLQkYRl+
  DCAR_026719 172 KARRCWSPELHKRFLQALQQLGGAHVGTPKQIRELMKVDGLTNDEVKSHLQKYRLH 227
                  68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.891168229IPR017930Myb domain
SuperFamilySSF466892.94E-17170230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-27171230IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-26172227IPR006447Myb domain, plants
PfamPF002492.9E-8174225IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MQKSLDYIES LEEERRKIQV FQRELPLCLD LVSQAIEKCK KDFYSPKQLS ECTEQASSEG  60
PVLEEFMPIK RAASSNEDEQ EPHFKKAKNV MTDNNRSEKS LKKSDWLRSD SPQKLSVVEV  120
NKNGNGGAFH PFKREDKKSE ETPVAAAASS TEEAGGSSGG CKAEDKEDPR RKARRCWSPE  180
LHKRFLQALQ QLGGAHVGTP KQIRELMKVD GLTNDEVKSH LQKYRLHTRR PSPSSNNAQA  240
PQFVVVGGIW MPPPPEYTAA ATTEEAGLMI RSSNGIYTPK ATLPKIRRQP SEADYSDKNG  300
SYNQTRSRSN SPESSSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-113PREDICTED: probable transcription factor GLK2
TrEMBLD7T9871e-113D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-113(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-75G2-like family protein